CCM2 – Binary Options göstəriciləri

İkili seçim brokerlərinin reytinqi:
  • Binomo
    Binomo

    Ən yaxşı ikili seçim brokeridir!
    Pulsuz təlim və demo hesabı!

Cerebral cavernous malformations 2 protein

Annotation score:5 out of 5

The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

– Experimental evidence at protein level i

This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.

Select a section on the left to see content.

This section provides any useful information about the protein, mostly biological knowledge.

The Gene Ontology (GO) project provides a set of hierarchical controlled vocabulary split into 3 categories:

GO – Biological process i

  • blood vessel endothelial cell differentiation Source: Ensembl
  • cell-cell junction organization Source: Ensembl
  • endothelial cell development Source: Ensembl
  • endothelial tube morphogenesis Source: MGI

Inferred from Mutant Phenotype

Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.

More information in the GO evidence code guide

Inferred from mutant phenotype i

Traceable Author Statement

Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.

More information in the GO evidence code guide

Traceable author statement i

UniProtKB Keywords constitute a controlled vocabulary with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.

Molecular function Developmental protein

This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.

Names & Taxonomy i

This subsection of the Names and taxonomy section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.

Protein names i

Manually curated information that is based on statements in scientific articles for which there is no experimental support.

Manual assertion based on opinion in i

This subsection of the Names and taxonomy section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.

Gene names i

This subsection of the Names and taxonomy section provides information on the name(s) of the organism that is the source of the protein sequence.

Organism i Homo sapiens (Human)

This subsection of the Names and taxonomy section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.

Taxonomic identifier i 9606 [NCBI]

This subsection of the Names and taxonomy section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.

Taxonomic lineage i cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo

This subsection of the Names and taxonomy section is present for entries that are part of a proteome, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.

Proteomes i

    UP000005640

A UniProt proteome can consist of several components.
The component name refers to the genomic component encoding a set of proteins.

Component i : Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More. HGNC i HGNC:21708 CCM2

Online Mendelian Inheritance in Man (OMIM)

More. MIM i 607929 gene

neXtProt; the human protein knowledge platform

More. neXtProt i NX_Q9BSQ5

This section provides information on the location and the topology of the mature protein in the cell.

Subcellular location i

Extracellular region or secreted

Automatic computational assertion

Graphics by Christian Stolte & Seán O’Donoghue; Source:

Other locations
  • Cytoplasm By similarity
Mitochondrion
  • mitochondrion Source: HPA
  • Other locations
    • cytoplasm Source: UniProtKB

    Inferred from Direct Assay

    Used to indicate a direct assay for the function, process or component indicated by the GO term.

    More information in the GO evidence code guide

    Inferred from direct assay i

    Keywords – Cellular component i

    This section provides information on the disease(s) and phenotype(s) associated with a protein.

    Pathology & Biotech i

    This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the OMIM database are represented with a controlled vocabulary in the following way:

    Involvement in disease i

    Cerebral cavernous malformations 2 (CCM2) 3 Publications

    Manually curated information for which there is published experimental evidence.

    Manual assertion based on experiment in i

    Related information in OMIM

    GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

    More. GeneReviews i

    MalaCards human disease database

    More. MalaCards i

    More. OpenTargets i

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More. Orphanet i

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More. PharmGKB i

    Feature key Position(s) Description Actions Graphical view Length

    This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.

    Natural variant i VAR_023577

    198 L → R in CCM2. 1 Publication

    Manual assertion based on experiment in i

    Corresponds to variant dbSNP:rs137852843Ensembl .

    1
    Natural variant i VAR_067352 215 Q → H in CCM2; associated with Q-229. 1 Publication

    Manual assertion based on experiment in i

    1
    Natural variant i VAR_067353 229 L → Q in CCM2; associated with H-215. 1 Publication

    Manual assertion based on experiment in i

    Keywords – Disease i

    Organism-specific databases

    More. DisGeNET i

    83605
    CCM2
    CCM2
    MIM i 603284 phenotype
    ENSG00000136280
    221061 Familial cerebral cavernous malformation
    PA26145

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More. Pharos i Q9BSQ5 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More. BioMuta i CCM2

    Domain mapping of disease mutations (DMDM)

    More. DMDM i 74733042

    This section describes post-translational modifications (PTMs) and/or processing events.

    PTM / Processing i

    Molecule processing

    This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.

    Chain i PRO_0000089424

    Feature key Position(s) Description Actions Graphical view Length
    1 – 444 Cerebral cavernous malformations 2 protein Add BLAST 444

    Amino acid modifications

    This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding lipids, glycans and protein cross-links.

    Modified residue i

    jPOST – Japan Proteome Standard Repository/Database

    More. jPOST i

    MassIVE – Mass Spectrometry Interactive Virtual Environment

    More. MassIVE i

    MaxQB – The MaxQuant DataBase

    More. MaxQB i

    PaxDb, a database of protein abundance averages across all three domains of life

    More. PaxDb i

    More. PeptideAtlas i

    PRoteomics IDEntifications database

    More. PRIDE i

    ProteomicsDB: a multi-organism proteome resource

    More. ProteomicsDB i

    Feature key Position(s) Description Actions Graphical view Length
    15 Phosphoserine Combined sources

    Manually validated information inferred from a combination of experimental and computational evidence.

    Manual assertion inferred from combination of experimental and computational evidence i

    1
    Modified residue i 164 Phosphoserine Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    1
    Modified residue i 384 Phosphoserine By similarity

    Manually curated information which has been propagated from a related experimentally characterized protein.

    Manual assertion inferred from sequence similarity to i

    • UniProtKB:Q8K2Y9 (CCM2_MOUSE)
    1
    Modified residue i 393 Phosphoserine By similarity

    Manual assertion inferred from sequence similarity to i

    • UniProtKB:Q8K2Y9 (CCM2_MOUSE)
    1
    Modified residue i 394 Phosphothreonine By similarity

    Manual assertion inferred from sequence similarity to i

    • UniProtKB:Q8K2Y9 (CCM2_MOUSE)
    1
    Modified residue i 396 Phosphoserine By similarity

    Manual assertion inferred from sequence similarity to i

    • UniProtKB:Q8K2Y9 (CCM2_MOUSE)
    1
    Modified residue i 399 Phosphothreonine By similarity

    Manual assertion inferred from sequence similarity to i

    Keywords – PTM i

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More. EPD i

    Q9BSQ5
    Q9BSQ5
    Q9BSQ5
    Q9BSQ5
    Q9BSQ5
    Q9BSQ5
    Q9BSQ5
    19677
    25314
    26772
    78919 [Q9BSQ5-1]
    78920 [Q9BSQ5-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More. iPTMnet i Q9BSQ5

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More. PhosphoSitePlus i Q9BSQ5

    This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More. Bgee i ENSG00000136280 Expressed in prefrontal cortex and 193 other tissues

    ExpressionAtlas, Differential and Baseline Expression

    More. ExpressionAtlas i Q9BSQ5 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More. Genevisible i Q9BSQ5 HS

    Organism-specific databases

    Human Protein Atlas

    More. HPA i ENSG00000136280 Low tissue specificity

    This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.

    This subsection of the ‘Interaction’ section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the ‘Function’ section).

    Subunit structure i

    Part of a complex with MAP2K3, MAP3K3 and RAC1. Binds RAC1 directly and independently of its nucleotide-bound state (By similarity).

    Interacts with HEG1 and KRIT1; KRIT1 greatly facilitates the interaction with HEG1 (By similarity).

    Interacts with PDCD10.

    By similarity 2 Publications

    Manual assertion based on experiment in i

    This subsection of the ‘Interaction section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the IntAct database. It is updated at every UniProt release.

    Binary interactions i

    Q9BSQ5
    With #Exp. IntAct
    DOK4 [Q8TEW6] 3 EBI-1573056,EBI-6918542
    HOXC8 [P31273] 3 EBI-1573056,EBI-1752118
    KRIT1 [O00522] 15 EBI-1573056,EBI-1573121
    PDCD10 [Q9BUL8] 5 EBI-1573056,EBI-740195
    RIN1 [Q13671] 3 EBI-1573056,EBI-366017
    TLNRD1 [Q9H1K6] 3 EBI-1573056,EBI-12344941
    TWIST2 [Q8WVJ9] 3 EBI-1573056,EBI-1797313
    VSTM2L [Q96N03] 3 EBI-1573056,EBI-948213
    Isoform 1 [Q9BSQ5-1]
    With #Exp. IntAct
    KRIT1 [O00522] 2 EBI-16157769,EBI-1573121
    MAP3K3 [Q99759] 6 EBI-16157769,EBI-307281

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More. BioGrid i 123696, 15 interactors

    ComplexPortal: manually curated resource of macromolecular complexes

    More. ComplexPortal i CPX-984 CCM complex

    CORUM comprehensive resource of mammalian protein complexes

    More. CORUM i Q9BSQ5

    Database of interacting proteins

    More. DIP i DIP-40609N

    Protein interaction database and analysis system

    More. IntAct i Q9BSQ5, 18 interactors

    Molecular INTeraction database

    More. MINT i Q9BSQ5

    STRING: functional protein association networks

    More. STRING i 9606.ENSP00000370503

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More. RNAct i Q9BSQ5 protein

    This section provides information on the tertiary and secondary structure of a protein.

    Secondary structure

    Show more detailsHide details

    Database of comparative protein structure models

    More. ModBase i

    Protein Data Bank in Europe – Knowledge Base

    More. PDBe-KB i

    Feature key Position(s) Description Actions Graphical view Length

    This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.

    Turn i

    57 – 60 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.

    Beta strand i

    63 – 76 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.

    Helix i

    85 – 97 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    13
    Beta strand i 110 – 115 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    6
    Beta strand i 117 – 127 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    11
    Beta strand i 130 – 135 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    6
    Helix i 136 – 138 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    3
    Beta strand i 139 – 146 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    8
    Beta strand i 151 – 157 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    7
    Beta strand i 193 – 202 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    10
    Helix i 203 – 219 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4WJ7
    17
    Helix i 225 – 238 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4TVQ
    14
    Helix i 288 – 291 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    4
    Helix i 293 – 306 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    14
    Turn i 307 – 309 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    3
    Helix i 312 – 326 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    15
    Helix i 331 – 342 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    12
    Helix i 344 – 356 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    13
    Helix i 359 – 371 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4FQN
    13
    Turn i 373 – 375 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    • PDB:4YL6
    3
    Helix i 422 – 435 Combined sources

    Manual assertion inferred from combination of experimental and computational evidence i

    3D structure databases

    SWISS-MODEL Repository – a database of annotated 3D protein structure models

    More. SMR i

    Q9BSQ5
    Search.
    Search.

    This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.

    Family & Domains i

    Domains and Repeats

    This subsection of the Family and Domains section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.

    Domain i

    More. GeneTree i

    InParanoid: Eukaryotic Ortholog Groups

    More. InParanoid i

    Identification of Orthologs from Complete Genome Data

    More. OMA i

    Database of Orthologous Groups

    More. OrthoDB i

    Database for complete collections of gene phylogenies

    More. PhylomeDB i

    TreeFam database of animal gene trees

    More. TreeFam i

    Feature key Position(s) Description Actions Graphical view Length
    59 – 248 PID PROSITE-ProRule annotation

    Manual validated information which has been generated by the UniProtKB automatic annotation system.

    Manual assertion according to rules i

    Region

    This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.

    Region i

    Feature key Position(s) Description Actions Graphical view Length
    283 – 376 Harmonin homology domain Add BLAST 94

    This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.

    Manual assertion based on experiment in i

    This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.

    Sequence similarities i

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More. eggNOG i

    ENOG410IHRT Eukaryota
    ENOG410ZBNR LUCA
    ENSGT00390000016168
    Q9BSQ5
    SFPECAH
    1446057at2759
    Q9BSQ5
    TF328517

    Family and domain databases

    Conserved Domains Database

    More. CDD i cd13516 HHD_CCM2, 1 hit

    Integrated resource of protein families, domains and functional sites

    More. InterPro i View protein in InterPro
    IPR032375 CCM2_C
    IPR026159 Malcavernin
    IPR006020 PTB/PI_dom

    The PANTHER Classification System

    More. PANTHER i PTHR21642 PTHR21642, 1 hit

    Pfam protein domain database

    More. Pfam i View protein in Pfam
    PF16545 CCM2_C, 1 hit

    PROSITE; a protein domain and family database

    More. PROSITE i View protein in PROSITE
    PS01179 PID, 1 hit

    This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight. The information is filed in different subsections. The current subsections and their content are listed below:

    This subsection of the Sequence section indicates if the canonical sequence displayed by default in the entry is complete or not.

    Sequence status i : Complete.

    This entry describes 4

    This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.

    isoforms i produced by alternative splicing . AlignAdd to basketAdded to basket

    This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

    This isoform has been chosen as the

    What is the canonical sequence?

    canonical i sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.

    It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.

    However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).

    The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x 64 + x 4 + x 3 + x + 1. The algorithm is described in the ISO 3309 standard.

    Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.
    Cyclic redundancy and other checksums
    Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993))

    Checksum: i 43F9C153B4DE460E

    The sequence of this isoform differs from the canonical sequence as follows:
    1-10: MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQTEFHTGYSMENE

    The sequence of this isoform differs from the canonical sequence as follows:
    158-248: Missing.

    The sequence of this isoform differs from the canonical sequence as follows:
    11-68: Missing.

    In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.

    Computationally mapped potential isoform sequences i

    There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket

    Entry Entry name Protein names Gene names Length Annotation
    C9JUH3 C9JUH3_HUMAN 347 Annotation score:

    Annotation score:1 out of 5

    The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

    A0A0A0MT72 A0A0A0MT72_HUMAN 438 Annotation score:

    Annotation score:1 out of 5

    The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

    E9PEC4 E9PEC4_HUMAN 271 Annotation score:

    Annotation score:1 out of 5

    The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

    A0A3B3IRS0 A0A3B3IRS0_HUMAN 256 Annotation score:

    Annotation score:1 out of 5

    The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

    H7C516 H7C516_HUMAN 135 Annotation score:

    Annotation score:1 out of 5

    The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.

    Experimental Info

    This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.

    Sequence conflict i

    Feature key Position(s) Description Actions Graphical view Length
    268 F → C in BAG53562 (PubMed:14702039). Curated 1
    Sequence conflict i 440 D → A in AAQ15228 (PubMed:15498874). Curated 1
    Sequence conflict i 444 A → ALWTVDGGAPTPSAQLS in AAQ15228 (PubMed:15498874). Curated 1

    Natural variant

    Feature key Position(s) Description Actions Graphical view Length
    Natural variant i VAR_023575 53 V → I 1 Publication

    Manual assertion based on experiment in i

    Corresponds to variant dbSNP:rs2107732Ensembl .

    1
    Natural variant i VAR_023576 120 V → I 1 Publication

    Manual assertion based on experiment in i

    Corresponds to variant dbSNP:rs11552377Ensembl .

    1
    Natural variant i VAR_023577 198 L → R in CCM2. 1 Publication

    Manual assertion based on experiment in i

    Corresponds to variant dbSNP:rs137852843Ensembl .

    1
    Natural variant i VAR_067352 215 Q → H in CCM2; associated with Q-229. 1 Publication

    Manual assertion based on experiment in i

    1
    Natural variant i VAR_067353 229 L → Q in CCM2; associated with H-215. 1 Publication

    Manual assertion based on experiment in i

    1
    Natural variant i VAR_050768 289 S → N. Corresponds to variant dbSNP:rs2289366Ensembl . 1

    Alternative sequence

    This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.

    Alternative sequence i VSP_024402

    Feature key Position(s) Description Actions Graphical view Length
    1 – 10 MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQT EFHTGYSMENE in isoform 2. 1 Publication

    Manual assertion based on opinion in i

    10
    Alternative sequence i VSP_046695 11 – 68 Missing in isoform 4. Curated AddBLAST 58
    Alternative sequence i VSP_046696 158 – 248 Missing in isoform 3. Curated AddBLAST 91

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    GenBank nucleotide sequence database

    DNA Data Bank of Japan; a nucleotide sequence database

    AK098005 mRNA Translation: BAG53562.1
    AF370392 mRNA Translation: AAQ15228.1
    AC004847 Genomic DNA No translation available.
    AC013416 Genomic DNA No translation available.
    CH236960 Genomic DNA Translation: EAL23746.1
    CH471128 Genomic DNA Translation: EAW61061.1
    CH471128 Genomic DNA Translation: EAW61064.1
    BC004903 mRNA Translation: AAH04903.1
    BC008859 mRNA Translation: AAH08859.1
    BC016832 mRNA Translation: AAH16832.1
    BC025958 mRNA Translation: AAH25958.1

    The Consensus CDS (CCDS) project

    More. CCDS i CCDS34630.1 [Q9BSQ5-2]
    CCDS5500.1 [Q9BSQ5-1]
    CCDS55108.1 [Q9BSQ5-3]
    CCDS55109.1 [Q9BSQ5-4]

    NCBI Reference Sequences

    More. RefSeq i NP_001025006.1, NM_001029835.2 [Q9BSQ5-2]
    NP_001161406.1, NM_001167934.1 [Q9BSQ5-4]
    NP_001161407.1, NM_001167935.1 [Q9BSQ5-3]
    NP_113631.1, NM_031443.3 [Q9BSQ5-1]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More. Ensembl i ENST00000258781; ENSP00000258781; ENSG00000136280 [Q9BSQ5-1]
    ENST00000381112; ENSP00000370503; ENSG00000136280 [Q9BSQ5-2]
    ENST00000541586; ENSP00000444725; ENSG00000136280 [Q9BSQ5-4]
    ENST00000544363; ENSP00000438035; ENSG00000136280 [Q9BSQ5-3]

    Database of genes from NCBI RefSeq genomes

    More. GeneID i 83605

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More. KEGG i hsa:83605

    UCSC genome browser

    More. UCSC i uc003tmo.4 human [Q9BSQ5-1]

    Keywords – Coding sequence diversity i

    This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (UniRef).

    Similar proteins i

    Protein Similar proteins Species Score Length Source
    Q9BSQ5-2 Cerebral cavernous malformations 2 protein
    Protein Similar proteins Species Score Length Source
    Q9BSQ5 CCM2 scaffold protein 444
    +43
    Q9BSQ5-2 CCM2 scaffold protein 466
    +31
    Q9BSQ5-3 Isoform 4 of Cerebral cavernous malformations 2 protein
    Protein Similar proteins Species Score Length Source
    Q9BSQ5 Cerebral cavernous malformations protein 2 homolog 485
    +639
    Q9BSQ5-3 Isoform 4 of Cerebral cavernous malformations 2 protein

    This section is used to point to information related to entries and found in data collections other than UniProtKB.

    Sequence databases

    Select the link destinations:
    EMBL i
    GenBank i
    DDBJ i
    AK098005 mRNA Translation: BAG53562.1
    AF370392 mRNA Translation: AAQ15228.1
    AC004847 Genomic DNA No translation available.
    AC013416 Genomic DNA No translation available.
    CH236960 Genomic DNA Translation: EAL23746.1
    CH471128 Genomic DNA Translation: EAW61061.1
    CH471128 Genomic DNA Translation: EAW61064.1
    BC004903 mRNA Translation: AAH04903.1
    BC008859 mRNA Translation: AAH08859.1
    BC016832 mRNA Translation: AAH16832.1
    BC025958 mRNA Translation: AAH25958.1
    CCDS i CCDS34630.1 [Q9BSQ5-2]
    CCDS5500.1 [Q9BSQ5-1]
    CCDS55108.1 [Q9BSQ5-3]
    CCDS55109.1 [Q9BSQ5-4]
    RefSeq i NP_001025006.1, NM_001029835.2 [Q9BSQ5-2]
    NP_001161406.1, NM_001167934.1 [Q9BSQ5-4]
    NP_001161407.1, NM_001167935.1 [Q9BSQ5-3]
    NP_113631.1, NM_031443.3 [Q9BSQ5-1]

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    Protein Data Bank RCSB

    Protein Data Bank Japan

    PDB entry Method Resolution (Å) Chain Positions PDBsum
    4FQN X-ray 1.90 A/B/C/D 283-379 [»]
    4TVQ X-ray 2.80 E 224-239 [»]
    4WJ7 X-ray 2.75 A/B/C/D 51-228 [»]
    4Y5O X-ray 2.35 A 283-379 [»]
    4YKC X-ray 2.70 A 290-444 [»]
    4YKD X-ray 1.93 A 290-376 [»]
    4YL6 X-ray 2.10 A 290-376 [»]
    SMR i Q9BSQ5
    ModBase i Search.
    PDBe-KB i Search.

    Protein-protein interaction databases

    BioGrid i 123696, 15 interactors
    ComplexPortal i CPX-984 CCM complex
    CORUM i Q9BSQ5
    DIP i DIP-40609N
    IntAct i Q9BSQ5, 18 interactors
    MINT i Q9BSQ5
    STRING i 9606.ENSP00000370503

    PTM databases

    iPTMnet i Q9BSQ5
    PhosphoSitePlus i Q9BSQ5

    Polymorphism and mutation databases

    BioMuta i CCM2
    DMDM i 74733042

    Proteomic databases

    EPD i Q9BSQ5
    jPOST i Q9BSQ5
    MassIVE i Q9BSQ5
    MaxQB i Q9BSQ5
    PaxDb i Q9BSQ5
    PeptideAtlas i Q9BSQ5
    PRIDE i Q9BSQ5
    ProteomicsDB i 19677
    25314
    26772
    78919 [Q9BSQ5-1]
    78920 [Q9BSQ5-2]

    Protocols and materials databases

    Antibodypedia a portal for validated antibodies

    More. Antibodypedia i 13519 320 antibodies

    The DNASU plasmid repository

    More. DNASU i 83605

    Genome annotation databases

    Ensembl i ENST00000258781; ENSP00000258781; ENSG00000136280 [Q9BSQ5-1]
    ENST00000381112; ENSP00000370503; ENSG00000136280 [Q9BSQ5-2]
    ENST00000541586; ENSP00000444725; ENSG00000136280 [Q9BSQ5-4]
    ENST00000544363; ENSP00000438035; ENSG00000136280 [Q9BSQ5-3]
    GeneID i 83605
    KEGG i hsa:83605
    UCSC i uc003tmo.4 human [Q9BSQ5-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More. CTD i 83605 DisGeNET i 83605

    GeneCards: human genes, protein and diseases

    More. GeneCards i CCM2 GeneReviews i CCM2 HGNC i HGNC:21708 CCM2 HPA i ENSG00000136280 Low tissue specificity MalaCards i CCM2 MIM i 603284 phenotype
    607929 gene neXtProt i NX_Q9BSQ5 OpenTargets i ENSG00000136280 Orphanet i 221061 Familial cerebral cavernous malformation PharmGKB i PA26145

    GenAtlas: human gene database

    More. GenAtlas i Search.

    Phylogenomic databases

    eggNOG i ENOG410IHRT Eukaryota
    ENOG410ZBNR LUCA
    GeneTree i ENSGT00390000016168
    InParanoid i Q9BSQ5
    OMA i SFPECAH
    OrthoDB i 1446057at2759
    PhylomeDB i Q9BSQ5
    TreeFam i TF328517

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More. ChiTaRS i CCM2 human

    The Gene Wiki collection of pages on human genes and proteins

    More. GeneWiki i CCM2

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More. GenomeRNAi i 83605 Pharos i Q9BSQ5 Tbio

    More. PRO i PR:Q9BSQ5 RNAct i Q9BSQ5 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More. SOURCE i Search.

    Gene expression databases

    Bgee i ENSG00000136280 Expressed in prefrontal cortex and 193 other tissues
    ExpressionAtlas i Q9BSQ5 baseline and differential
    Genevisible i Q9BSQ5 HS

    Family and domain databases

    ProtoNet; Automatic hierarchical classification of proteins

    More. ProtoNet i

    MobiDB: a database of protein disorder and mobility annotations

    More. MobiDB i

    CDD i cd13516 HHD_CCM2, 1 hit
    InterPro i View protein in InterPro
    IPR032375 CCM2_C
    IPR026159 Malcavernin
    IPR006020 PTB/PI_dom
    PANTHER i PTHR21642 PTHR21642, 1 hit
    Pfam i View protein in Pfam
    PF16545 CCM2_C, 1 hit
    PROSITE i View protein in PROSITE
    PS01179 PID, 1 hit
    Search.
    Search.

    This section provides general information on the entry.

    Entry information i

    This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.

    Entry name i CCM2_HUMAN

    This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.

    Accession i Q9BSQ5 Primary (citable) accession number: Q9BSQ5
    Secondary accession number(s): A4D2L4

    , B3KUV0, D3DVL4, E9PDJ3, F5H0E1, F5H551, Q71RE5, Q8TAT4

    This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the canonical sequence are also displayed.

    Entry history i Integrated into UniProtKB/Swiss-Prot: October 11, 2005 Last sequence update: June 1, 2001 Last modified: April 22, 2020 This is version 155 of the entry and version 1 of the sequence. See complete history.

    This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (reviewed) or to the computer-annotated TrEMBL section (unreviewed).

    Entry status i Reviewed (UniProtKB/Swiss-Prot) Annotation program Chordata Protein Annotation Program Disclaimer Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    This section contains any relevant information that doesn’t fit in any other defined sections

    Сигналы по индикаторам бинарных опционов на валютные пары

    Торговля валютными парами на бинарных опционах стала очень популярна у трейдеров во всём мире. Даже те, кто начинал когда-то трейдинг на Форекс вскоре поняли, что на бинарных опционах можно заработать намного больше и в разы быстрее.

    Я предлагаю Вам ознакомиться с бесплатными сигналами по валютным парам, используя индикаторы и технический анализ. Они легки в использовании, понятны и доступны. Освоить их сможет даже новичок.

    В течение многих лет в трейдинге формировалось направление технического анализа, и это не только чертежи и фигуры. Одаренные математики разрабатывали различные формулы, из которых строились дополнительные графики, получившие название – индикаторы цены. Некоторые из проектов стали очень популярными и заслужили всеобщее признание. Сегодня практически каждый трейдер так или иначе обращает внимание на какие-либо индикаторы. Я в своей торговле столкнулась с ситуацией, что если сигналов слишком много, то график становится переполнен и непонятен. Поэтому, решила обратить внимание на специализированные сервисы и получила более удобный подход к анализу, выраженный в таблице сигналов, основанных на значениях того или иного индикатора.

    Взгляните на комплексный инструмент, расположенный ниже. Вы можете следить за появлением прибыльных сигналов в онлайн режиме.

    Как видите, здесь присутствуют все стандартные таймфреймы от 5 минут до 1 месяца. Среди индикаторов есть как трендовые (к примеру, Alligator от Билла Вильямса, ADX), так и осцилляторы (RSI, Stochastic и т.д.).

    Значения каждого сигнала можно проверить, нажав на надпись: «Покупать» или «Продавать» , в нужном временном интервале. Откроется реальный график с этим индикатором в режиме онлайн. Многие будут согласны, что это невероятно удобно, именно поэтому я выбрала этот сервис.

    В целом система выглядит многообещающе. Тем не менее, трейдеры-новички очень часто совершают ошибку, пытаясь использовать все индикаторы и таймфреймы сразу. Иногда, сигналы противоречат друг другу, это их вводит в ступор, они начинают сомневаться в качестве сигналов. Чтобы этого избежать, необходимо всесторонне оценить рынок, выявив предпосылки трендового движения либо консолидации цен. Рассмотрим подробнее механику использования комплексного анализа при торговле бинарными опционами.

    Шаг первый. Перед тем, как приступить к просмотру индикаторов, рекомендую открыть экономический календарь и оценить новостной фон в том инструменте, который планируете торговать. Это требуется, чтобы выяснить вероятность формирования сильного тренда внутри дня. Кроме того, волатильность на рынке может возрасти при нахождении цены у исторических экстремумов (максимумов и минимумов), либо сильных уровней поддержки и сопротивления. Многое зависит и от времени торгов. Сильные движения на высоких объемах чаще встречаются во время Европейской торговой сессии (с 11:00 до 19:00 МСК). Таким образом, первоочередная задача – понять рыночную ситуацию на текущий момент, есть ли предпосылки для сильного движения и т.д.

    Шаг второй. Следующий шаг зависит от обстоятельств. Если есть новости, на рынке появился импульс (сильное краткосрочное движение), то необходимо применять трендовые сигналы. Лучше всего подойдут Alligator, ADX и SAR, а также менее известный AROON (его можно и исключить, достаточно 3). Alligator указывает на основное направление движения, когда все его линии пересечены в ту или иную сторону. Что касается ADX, то он оценивает силу тренда, а Parabolic SAR – показывает точку входа, если цена действительно растет или падает. В итоге, когда все четыре индикатора одновременно показывают – «Продавать» или «Покупать», следует входить в сделку в соответствующем направлении.

    Альтернативы. Другая ситуация – рынок спокоен, новостей нет, исторических экстремумов (максимумов и минимумов) тоже. Внутри дня нет импульсов, возможно Вам удобнее торговать в течение Азиатской сессии (ночное время по МСК). В таком случае, всё складывается в пользу применения осцилляторов (RSI, CCI, MACD, Stochastic), при этом для страховки рекомендуется сверять показания ADX, лучше, чтобы он был в нейтральной зоне. Между делом скажу, что ADX – это невероятно полезный инструмент в любой ситуации, практически всегда, когда он ниже 25 на рынке флэт. Возвращаясь к торговле, получаем итог – если все 4 осциллятора показывают «Покупать» или «Продавать», а ADX – «Нейтрально», то входим в сделку.

    Примечание. Важный вопрос – выбор таймфреймов. Многие слышали идею трех экранов Элдера, когда применяются сразу 3 временных интервала, на старшем оценивается тренд, на младших перекупленность или перепроданность осцилляторами. Теоретически это должно работать, но практически я бы рекомендовала сосредоточиться на одном интервале в зависимости от времени экспирации (сроков закрытия) опциона. К примеру, для опционов – 5, 15, 30 минут достаточно обратить внимание на М5 (от 1 до 6 свечей), для 60 минут хватает М15 (4 свечи). Если Вы будете «блуждать» по нескольким интервалам одновременно, то можете получить множество ложных сигналов и пропустить верные. Я сама сталкивалась с такой проблемой, поэтому советую сразу учиться еще и на чужих ошибках.

    Пример первый. Для углубленного понимания вышеизложенной концепции использования комплексного анализа индикаторов через специализированный сервис, я разберу теорию на конкретной ситуации. В качестве примера возьмем самую популярную валютную пару – EURUSD. Рассмотрим недавнюю ситуацию – 15 декабря 2020 года. Я отобрала для Вас только свежие сделки (на момент написания статьи), потому что рынок постоянно меняется. Мне, например, было тяжело изучать информацию по древним графикам.

    Мы видим, что по Еврозоне был сильный новостной фон, выходили данные по индексу деловой активности, а также в США индекс потребительских цен, информация по безработице, а за день до этого повышение процентной ставки. Иными словами, новостей много и все они значимые. Не стоит пытаться определить куда пойдет рынок по новостям, реакция бывает неоднозначной, мы лишь констатируем, что в этот день будет повышенный интерес у участников рынка.

    Плюс, евро находится у годового минимума (пробит уровень 1.04624 – экстремум 3 декабря 2020 года), что говорит о вероятности повышенной волатильности внутри дня из-за скопления стоп-ордеров в этой зоне.

    Теперь взглянем на индикаторы. Так как мы ориентируемся на тренд, то применим трендовую схему: ADX должен быть больше 25, Линии Alligator’а пересечены вниз, Parabolic SAR направлен вниз.

    Как видите, на изображении отмечены зоны, когда индикаторы в сервисе показывали сигнал «Продавать» . Стоит отметить, что SAR довольно хорошо фильтрует сигналы предыдущих двух индикаторов, поэтому не стоит входить в сделку, когда он не дает сигналов. 15 декабря можно было достойно обогатиться, смотря за индикаторами на М5 и покупая опционы вниз с экспирацией от 5 до 30 минут.

    Вышеуказанная система торговли даёт редкие, но более точные рекомендации для входа в позицию. Иногда, трендовые движения будут возникать и при полном затишье на рынке. В действительности можно использовать индикаторы в меньшей комплектации, получая большее количество сигналов, но тогда и процент прибыльных сделок значительно понизится.

    Пример второй . Рассмотрим случай, когда на рынке была консолидация (флэт). Как раз за день до предыдущей ситуации – 14 декабря, было «затишье перед бурей». Все инвесторы ждали решения по процентной ставке в США, и никто толком не торговал. В результате цена весь день была в коридоре.

    Рассмотрим осцилляторы из сервиса и их значения, а также ADX. Зеленым отмечены зоны, когда все индикаторы указывали на покупки или продажи. В итоге, даже в такой вялый день можно было прилично заработать. Стоит отметить, что MACD иногда даёт противоречивую информацию на фоне других индикаторов, его периодически можно исключать из схемы.

    При должном опыте использования вышеуказанных стратегий, вероятность прибыльной сделки может достигать 80-90%. Более того, в этом направлении возможно абсолютно неограниченное развитие. Некоторые индикаторы можно исключать, другие добавлять и так далее. Рассматривать больше условий для формирования трендов, добавлять фильтры, применить технический анализ и построить канал для торговли.

    Резюме технических индикаторов

    Сейчас распишу Вам ещё один вариант использования технических индикаторов на валютные пары, он немного проще.

    Вы можете следить за появлением прибыльных сигналов прямо здесь в онлайн режиме. Ведь специально для Вас я интегрировала таблицу с техническим анализом на свой сайт, и она работает в режиме реального времени. Время указано в таблицах по GMT.

    А теперь давайте разберёмся в стратегии торговли валютными парами, как правильно анализировать данные индикаторы. Если Вы видите, что напротив определённой пары имеется надпись «Активно покупать» во всех временных отрезках (5 минут, 15 минут, Часовой, Дневной), это означает, что прогноз изменения стоимости актива стабильный. В ближайшее время эта тенденция сохранится, и цена пары будет продолжать расти. Поэтому стоит покупать опцион на повышение на ближайшие 15-30 минут минут.

    Если же Вы видите, что напротив определённой пары имеется надпись «Активно продавать» во всех временных отрезках (5 минут, 15 минут, Часовой, Дневной), это означает, что прогноз изменения стоимости актива также максимально сильный. В ближайшее время эта тенденция сохранится, и цена пары будет продолжать падать. Поэтому стоит покупать опцион на понижение на ближайшие 15-30 минут.

    Если в таблице напротив валютной пары по разным временным отрезкам имеются разные сигналы к действию, опцион ни в коем случае не открывайте. Сигнал будет слабым и противоречивым.

    Дополнительно Вы можете ориентироваться на сделки других трейдеров, какое направление они выбирают для валютных пар. Если процент выбора более 75%, то подсказкой можно пользоваться.

    Советую вам ознакомиться также со Стратегией торговли бинарными опционами по Торговым сигналам. Там Вы найдёте руководство по использованию сигналов при трейдинге индексами, сырьевыми товарами и акциями.

    Хочу обратить Ваше внимание, что стоимость валютных пар очень подвержена различным экономическим новостям. Поэтому открывая опцион, убедитесь, что в ближайшие 30 минут не намечается выход новостей. Более подробно со Стратегией торговли по новостям экономического календаря Вы можете ознакомиться, перейдя по ссылке. Там можно найти и сам календарь в онлайн режиме. А все предсказания по валютным парам, основываясь на экономический календарь можно найти в рубрике Новости.

    Ещё больше способов торговли по валютным парам описаны в статье Стратегии торговли бинарными опционами (полный список).

    Сигналы forex/cfd

    Хотите начинать зарабатывать с самого начала карьеры трейдера? Предоставляю вашему вниманию лучшие бесплатные сигналы для трейдеров бинарных опционов! Это не «гарантированный заработок» (в нашем деле такого просто не может быть), но прекрасная возможность научиться трейдингу, работая с простыми и надежными алгоритмами.

    Пользоваться роботами для форекс/бинарных опционов – это совершенно нормально: ведь активно работающий трейдер не будет успевать совершать все нужные расчеты. Но какие роботы лучше выбирать? Ознакомьтесь с моим личным рейтингом роботов, основанном на личном опыте торговли!

    Binary Options Robot Abi – одна из лучших программ для помощи трейдерам бинарных опционов. Я сама активно пользуюсь «услугами» этого помощника, которому можно поручить практически всю рутинную работу, связанную с расчетами. В итоге вы можете сосредоточиться на аналитике – и преуспеть в заключении сделок!

    Относительно новый, но уже популярный робот для бинарных опционов. По моему мнению, это лучший из новых программных продуктов на трейдерском рынке, поэтому смело могу рекомендовать его своим читателям. Узнайте о преимуществах робота TradersBuddy, прочитав статью!

    Не устраивают стандартные роботы бинарных опционов? Создайте свой робот и полностью настройте его под себя. Сервис IQ Robots (от IQ Option) позволит любому пользователю создать собственную программу для помощи в заключении сделок – и пользоваться всеми преимуществами, которое она даёт!

    Хорошую программу не грех и прорекламировать – но этот материал я хочу посвятить антирекламе. Со всей уверенностью утверждаю, что робот для бинарных опционов “Элли” – совершенно бесполезный “помощник”, использовать которого не рекомендую никому и никогда.

    Как выбрать самого надежного торгового робота? Представляю вам собственный рейтинг, где сообщаю, какие программы являются самыми эффективными, какие – самыми простыми, какие – самыми удобными. Я лично пользовалась всеми программами, которые анализирую, и готова отвечать за все свои характеристики!

    Почему торговые сигнальные системы так популярны? Почему торговать с их помощью лучше, чем “вживую”? Какие помощники являются самыми надежными? В этой статье я резюмирую всё написанное мной о роботах бинарных опционов и доступно объясняю, почему рекомендую пользоваться их помощью.

    Копирование сделок трейдеров – это, вопреки стереотипам, не самая простая работа. В этом материале я описываю, какими способами можно и нужно копировать сделки, если вы рассчитываете на стабильные и солидные выигрыши. Для достоверности привожу наглядные примеры – с графиками и чертежами.

    В какой момент нужно заключать сделку, чтобы шансы на успех были наибольшими? Это помогут решить эффективные инструменты – индикаторы бинарных опционов. Вкратце рассказываю о тридцати самых популярных индикаторах и привожу подробные ссылки на их описания.

    Страница 1 из 4

    Раздел Сигналы forex/cfd/бинарных опционов познакомит Вас с различными способами получения торговых сигналов для forex/cfd/бинарных опционов бесплатно для успешной торговли. Они Вам пригодятся, если Вы только пришли на финансовый рынок и пока не нашли подходящей для себя стратегии, или если желаете увеличить свой депозит, следуя советам и подсказкам опытных трейдеров, их онлайн сигналам.

    На выбор предоставляются:

      • бесплатные торговые сигналы для forex/cfd/Бинарных Опционов;
      • индикаторы для бинарных опционов по валютным парам, акциям, индексам и сырьевым товарам;
      • платные программы , которые в автоматическом режиме посылают сигналы после комплексного анализа рынка;
      • список брокеров forex/cfd/бинарных опционов , предоставляющих своим клиентам сигналы для успешной торговли.

    Я уверена, что Вы найдёте подходящий для себя способ получения лучших, надёжных и прибыльных сигналов! Ведь сотни трейдеров ищут бесплатные, торговые сигналы в живую онлайн.

    Стоит ли использовать сигналы для forex/cfd/бинарных опционов?

    Первое, что приходит на ум о сигналах – это один из хороших моментов моей карьеры, который очень сильно помог на первых порах. По сути, я сравнивала свои наработки и стратегии с полученными рекомендациями по входам в сделки, и такая схема работы вывела мои навыки на совершенно новый уровень.

    Сейчас есть отличные как платные, так и бесплатные сервисы в зависимости от Ваших возможностей. Всё это на руку для начинающих трейдеров опционами, и позволит избежать убытков на счёте. Плюс, поддерживает психологически, когда Ваши домыслы совпадают с получаемыми советами.

    Как правило, все сигналы основаны на применении технического анализа (фундаментальный больше используется в аналитике). Где-то используются индикаторы, где-то автор вручную даёт рекомендации. Я сама когда-то была в подобной ситуации, и если Вы начинающий трейдер, то желательно не просто копировать сделки, а пытаться понять почему был дан сигнал.

    Для чего это нужно? На рынке постоянная конкуренция, и он в любой момент может начать вести себя иначе. Когда Вы понимаете смысл сигналов, а также на чем они основаны, то сможете легко подстроиться под ситуацию, либо начать торговать самостоятельно.

    Торговые сигналы для forex/cfd/опционов – это мощный инструмент в развитии, а также «подушка безопасности» для начинающего трейдера. Они нужны, чтобы совершенствовать свою торговлю, находить какие-то новые идеи, иметь психологическую поддержку и подтверждение собственных сделок. Удачного Вам профита, друзья!

    İkili seçim brokerlərinin reytinqi:
    • Binomo
      Binomo

      Ən yaxşı ikili seçim brokeridir!
      Pulsuz təlim və demo hesabı!

  • Pul hara qoyulacaq?
    Bir cavab yazın

    ;-) :| :x :twisted: :smile: :shock: :sad: :roll: :razz: :oops: :o :mrgreen: :lol: :idea: :grin: :evil: :cry: :cool: :arrow: :???: :?: :!: